PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn099501
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family ARR-B
Protein Properties Length: 592aa    MW: 66901.5 Da    PI: 6.4718
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn099501genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like75.95.3e-24199252155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 k+r++W+ +LH++Fv+av+q+ G +k  Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  Achn099501 199 KARVVWNVDLHQKFVKAVNQI-GFDKVGPKKILDLMNVPWLTRENVASHLQKYRL 252
                 68*******************.9*******************************8 PP

2Response_reg74.93.1e-25191271109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl+vdD+ + +++l+++l+k  y ev+++  + eal+ll+e++  +D+++ D++mp+mdG++ll++   e  +lp+++++  ge + + + ++ Ga 
    Achn099501  19 VLVVDDDLAWLRILEKMLKKCSY-EVTTCCLAIEALDLLRERKdgFDIVISDVNMPDMDGFKLLEHVGLEM-DLPVLMMSVDGETSRVMRGVQHGAC 113
                   89*********************.***************999999**********************6644.8************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ ++el++
    Achn099501 114 DYLLKPIRMKELRN 127
                   ***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.4E-1411568IPR017053Response regulator B-type, plant
SuperFamilySSF521721.57E-3416141IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23009.7E-4216140No hitNo description
SMARTSM004483.2E-3017129IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011041.64518133IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.9E-2219128IPR001789Signal transduction response regulator, receiver domain
CDDcd001564.28E-2820133No hitNo description
Gene3DG3DSA:1.10.10.602.6E-27197257IPR009057Homeodomain-like
SuperFamilySSF466899.86E-17197256IPR009057Homeodomain-like
TIGRFAMsTIGR015574.5E-21199252IPR006447Myb domain, plants
PfamPF002491.2E-6201251IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009735Biological Processresponse to cytokinin
GO:0010082Biological Processregulation of root meristem growth
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 592 aa     Download sequence    Send to blast
METGFSSPRT DAFPAGLRVL VVDDDLAWLR ILEKMLKKCS YEVTTCCLAI EALDLLRERK  60
DGFDIVISDV NMPDMDGFKL LEHVGLEMDL PVLMMSVDGE TSRVMRGVQH GACDYLLKPI  120
RMKELRNIWQ HVFRKRIHEV RDIESHEGID EIQMMRYGSD QSDDWHSLSG HDLTSGKKRR  180
DVDNKYDDKD FGDLSSAKKA RVVWNVDLHQ KFVKAVNQIG FDKVGPKKIL DLMNVPWLTR  240
ENVASHLQKY RLYLSRLQKE NDLKASFGGI KQSDSSSKDP AGNLSLPDSI KTQQNDSACG  300
IYGMSGNKTL SQSVDQKIHE SDLKGIVSLS VMETKKAPIH DIPDPSKASC SRMGPNHPFG  360
QREQDVNYTR FDSSIPKQYA WSQVPEVQFK HEHKTLRRVE NGFNHLPLPG LQHHVQVDFI  420
QPTPSASSRP FNKEREKPAS IEIKPSYNNF SSHQTRQVSP IGTVTNLFPV QSEIYATSFH  480
TPAQTPTTTL STKNHGLNQI FVNELESAQR NLISGSCLGF ASSDGDLFSC LLQGNSYATN  540
VELQNKESFN HNCPELFAET PACLNDGQRF DYEYPWESME YPVIDQGLFI V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-17195257163ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00010PBMTransfer from AT1G67710Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002267616.10.0PREDICTED: two-component response regulator ARR11
TrEMBLD7TAK20.0D7TAK2_VITVI; Putative uncharacterized protein
STRINGVIT_01s0010g02230.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA67882433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67710.11e-126response regulator 11